TFAP2C polyclonal antibody (A01)
  • TFAP2C polyclonal antibody (A01)

TFAP2C polyclonal antibody (A01)

Ref: AB-H00007022-A01
TFAP2C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TFAP2C.
Información adicional
Size 50 uL
Gene Name TFAP2C
Gene Alias AP2-GAMMA|ERF1|TFAP2G|hAP-2g
Gene Description transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFAP2C (NP_003213, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7022

Enviar uma mensagem


TFAP2C polyclonal antibody (A01)

TFAP2C polyclonal antibody (A01)