TFAP2B polyclonal antibody (A01)
  • TFAP2B polyclonal antibody (A01)

TFAP2B polyclonal antibody (A01)

Ref: AB-H00007021-A01
TFAP2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TFAP2B.
Información adicional
Size 50 uL
Gene Name TFAP2B
Gene Alias AP-2B|AP2-B|MGC21381
Gene Description transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFAP2B (NP_003212, 73 a.a. ~ 182 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7021

Enviar uma mensagem


TFAP2B polyclonal antibody (A01)

TFAP2B polyclonal antibody (A01)