TFAP2A monoclonal antibody (M01), clone 2G5
  • TFAP2A monoclonal antibody (M01), clone 2G5

TFAP2A monoclonal antibody (M01), clone 2G5

Ref: AB-H00007020-M01
TFAP2A monoclonal antibody (M01), clone 2G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFAP2A.
Información adicional
Size 100 ug
Gene Name TFAP2A
Gene Alias AP-2|AP-2alpha|AP2TF|BOFS|TFAP2
Gene Description transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFAP2A (AAH17754, 99 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7020
Clone Number 2G5
Iso type IgG1 Kappa

Enviar uma mensagem


TFAP2A monoclonal antibody (M01), clone 2G5

TFAP2A monoclonal antibody (M01), clone 2G5