TFAM MaxPab rabbit polyclonal antibody (D01)
  • TFAM MaxPab rabbit polyclonal antibody (D01)

TFAM MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007019-D01
TFAM MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TFAM protein.
Información adicional
Size 100 uL
Gene Name TFAM
Gene Alias MtTF1|TCF6|TCF6L1|TCF6L2|TCF6L3|mtTFA
Gene Description transcription factor A, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7019

Enviar uma mensagem


TFAM MaxPab rabbit polyclonal antibody (D01)

TFAM MaxPab rabbit polyclonal antibody (D01)