TF MaxPab mouse polyclonal antibody (B01)
  • TF MaxPab mouse polyclonal antibody (B01)

TF MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00007018-B01
TF MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TF protein.
Información adicional
Size 50 uL
Gene Name TF
Gene Alias DKFZp781D0156|PRO1557|PRO2086
Gene Description transferrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TF (NP_001054.1, 1 a.a. ~ 698 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7018

Enviar uma mensagem


TF MaxPab mouse polyclonal antibody (B01)

TF MaxPab mouse polyclonal antibody (B01)