TESK1 monoclonal antibody (M01), clone 1D11
  • TESK1 monoclonal antibody (M01), clone 1D11

TESK1 monoclonal antibody (M01), clone 1D11

Ref: AB-H00007016-M01
TESK1 monoclonal antibody (M01), clone 1D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TESK1.
Información adicional
Size 100 ug
Gene Name TESK1
Gene Alias -
Gene Description testis-specific kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TESK1 (AAH67130, 266 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7016
Clone Number 1D11
Iso type IgG1 kappa

Enviar uma mensagem


TESK1 monoclonal antibody (M01), clone 1D11

TESK1 monoclonal antibody (M01), clone 1D11