TEK monoclonal antibody (M09), clone 1G10
  • TEK monoclonal antibody (M09), clone 1G10

TEK monoclonal antibody (M09), clone 1G10

Ref: AB-H00007010-M09
TEK monoclonal antibody (M09), clone 1G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TEK.
Información adicional
Size 100 ug
Gene Name TEK
Gene Alias CD202B|TIE-2|TIE2|VMCM|VMCM1
Gene Description TEK tyrosine kinase, endothelial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TEK (AAH35514, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7010
Clone Number 1G10
Iso type IgG2a Kappa

Enviar uma mensagem


TEK monoclonal antibody (M09), clone 1G10

TEK monoclonal antibody (M09), clone 1G10