TEC monoclonal antibody (M01), clone 1C11
  • TEC monoclonal antibody (M01), clone 1C11

TEC monoclonal antibody (M01), clone 1C11

Ref: AB-H00007006-M01
TEC monoclonal antibody (M01), clone 1C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TEC.
Información adicional
Size 100 ug
Gene Name TEC
Gene Alias MGC126760|MGC126762|PSCTK4
Gene Description tec protein tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq KYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TEC (NP_003206, 311 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7006
Clone Number 1C11
Iso type IgG2b Kappa

Enviar uma mensagem


TEC monoclonal antibody (M01), clone 1C11

TEC monoclonal antibody (M01), clone 1C11