TDG purified MaxPab mouse polyclonal antibody (B01P)
  • TDG purified MaxPab mouse polyclonal antibody (B01P)

TDG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006996-B01P
TDG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TDG protein.
Información adicional
Size 50 ug
Gene Name TDG
Gene Alias -
Gene Description thymine-DNA glycosylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TDG (AAH37557.1, 1 a.a. ~ 410 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6996

Enviar uma mensagem


TDG purified MaxPab mouse polyclonal antibody (B01P)

TDG purified MaxPab mouse polyclonal antibody (B01P)