TCOF1 monoclonal antibody (M02), clone 8H3
  • TCOF1 monoclonal antibody (M02), clone 8H3

TCOF1 monoclonal antibody (M02), clone 8H3

Ref: AB-H00006949-M02
TCOF1 monoclonal antibody (M02), clone 8H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCOF1.
Información adicional
Size 100 ug
Gene Name TCOF1
Gene Alias MFD1|treacle
Gene Description Treacher Collins-Franceschetti syndrome 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCOF1 (NP_001008657, 2 a.a. ~ 82 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6949
Clone Number 8H3
Iso type IgG1 Kappa

Enviar uma mensagem


TCOF1 monoclonal antibody (M02), clone 8H3

TCOF1 monoclonal antibody (M02), clone 8H3