TCN1 purified MaxPab mouse polyclonal antibody (B01P)
  • TCN1 purified MaxPab mouse polyclonal antibody (B01P)

TCN1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006947-B01P
TCN1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TCN1 protein.
Información adicional
Size 50 ug
Gene Name TCN1
Gene Alias TC1|TCI
Gene Description transcobalamin I (vitamin B12 binding protein, R binder family)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TCN1 (NP_001053.2, 1 a.a. ~ 433 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6947

Enviar uma mensagem


TCN1 purified MaxPab mouse polyclonal antibody (B01P)

TCN1 purified MaxPab mouse polyclonal antibody (B01P)