MLX purified MaxPab mouse polyclonal antibody (B02P)
  • MLX purified MaxPab mouse polyclonal antibody (B02P)

MLX purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00006945-B02P
MLX purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MLX protein.
Información adicional
Size 50 ug
Gene Name MLX
Gene Alias MAD7|MXD7|TCFL4|bHLHd13
Gene Description MAX-like protein X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MLX (NP_937848.1, 1 a.a. ~ 214 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6945

Enviar uma mensagem


MLX purified MaxPab mouse polyclonal antibody (B02P)

MLX purified MaxPab mouse polyclonal antibody (B02P)