TCF7 purified MaxPab rabbit polyclonal antibody (D01P)
  • TCF7 purified MaxPab rabbit polyclonal antibody (D01P)

TCF7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006932-D01P
TCF7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TCF7 protein.
Información adicional
Size 100 ug
Gene Name TCF7
Gene Alias FLJ36364|MGC47735|TCF-1
Gene Description transcription factor 7 (T-cell specific, HMG-box)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TCF7 (NP_003193.2, 1 a.a. ~ 384 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6932

Enviar uma mensagem


TCF7 purified MaxPab rabbit polyclonal antibody (D01P)

TCF7 purified MaxPab rabbit polyclonal antibody (D01P)