CNTN2 polyclonal antibody (A01)
  • CNTN2 polyclonal antibody (A01)

CNTN2 polyclonal antibody (A01)

Ref: AB-H00006900-A01
CNTN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CNTN2.
Información adicional
Size 50 uL
Gene Name CNTN2
Gene Alias AXT|DKFZp781D102|FLJ42746|MGC157722|TAG-1|TAX|TAX1
Gene Description contactin 2 (axonal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNTN2 (NP_005067, 825 a.a. ~ 923 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6900

Enviar uma mensagem


CNTN2 polyclonal antibody (A01)

CNTN2 polyclonal antibody (A01)