TAF10 purified MaxPab rabbit polyclonal antibody (D01P)
  • TAF10 purified MaxPab rabbit polyclonal antibody (D01P)

TAF10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006881-D01P
TAF10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TAF10 protein.
Información adicional
Size 100 ug
Gene Name TAF10
Gene Alias TAF2A|TAF2H|TAFII30
Gene Description TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAF10 (NP_006275.1, 1 a.a. ~ 218 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6881

Enviar uma mensagem


TAF10 purified MaxPab rabbit polyclonal antibody (D01P)

TAF10 purified MaxPab rabbit polyclonal antibody (D01P)