TAF6 purified MaxPab rabbit polyclonal antibody (D01P)
  • TAF6 purified MaxPab rabbit polyclonal antibody (D01P)

TAF6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006878-D01P
TAF6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TAF6 protein.
Información adicional
Size 100 ug
Gene Name TAF6
Gene Alias DKFZp781E21155|MGC:8964|TAF2E|TAFII70|TAFII80|TAFII85
Gene Description TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAF6 (NP_005632.1, 1 a.a. ~ 677 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6878

Enviar uma mensagem


TAF6 purified MaxPab rabbit polyclonal antibody (D01P)

TAF6 purified MaxPab rabbit polyclonal antibody (D01P)