TAGLN monoclonal antibody (M03), clone 1C4
  • TAGLN monoclonal antibody (M03), clone 1C4

TAGLN monoclonal antibody (M03), clone 1C4

Ref: AB-H00006876-M03
TAGLN monoclonal antibody (M03), clone 1C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TAGLN.
Información adicional
Size 100 ug
Gene Name TAGLN
Gene Alias DKFZp686P11128|SM22|SMCC|TAGLN1|WS3-10
Gene Description transgelin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAGLN (NP_001001522, 19 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6876
Clone Number 1C4
Iso type IgG2b Kappa

Enviar uma mensagem


TAGLN monoclonal antibody (M03), clone 1C4

TAGLN monoclonal antibody (M03), clone 1C4