TAGLN purified MaxPab rabbit polyclonal antibody (D01P)
  • TAGLN purified MaxPab rabbit polyclonal antibody (D01P)

TAGLN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006876-D01P
TAGLN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TAGLN protein.
Información adicional
Size 100 ug
Gene Name TAGLN
Gene Alias DKFZp686P11128|SM22|SMCC|TAGLN1|WS3-10
Gene Description transgelin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAGLN (NP_001001522.1, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6876

Enviar uma mensagem


TAGLN purified MaxPab rabbit polyclonal antibody (D01P)

TAGLN purified MaxPab rabbit polyclonal antibody (D01P)