SYN1 monoclonal antibody (M04), clone 3H6
  • SYN1 monoclonal antibody (M04), clone 3H6

SYN1 monoclonal antibody (M04), clone 3H6

Ref: AB-H00006853-M04
SYN1 monoclonal antibody (M04), clone 3H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SYN1.
Información adicional
Size 100 ug
Gene Name SYN1
Gene Alias SYN1a|SYN1b|SYNI
Gene Description synapsin I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYN1 (NP_008881, 362 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6853
Clone Number 3H6
Iso type IgG2b Lambda

Enviar uma mensagem


SYN1 monoclonal antibody (M04), clone 3H6

SYN1 monoclonal antibody (M04), clone 3H6