SYK monoclonal antibody (M01A), clone 4A7
  • SYK monoclonal antibody (M01A), clone 4A7

SYK monoclonal antibody (M01A), clone 4A7

Ref: AB-H00006850-M01A
SYK monoclonal antibody (M01A), clone 4A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SYK.
Información adicional
Size 200 uL
Gene Name SYK
Gene Alias DKFZp313N1010|FLJ25043|FLJ37489
Gene Description spleen tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYK (AAH01645, 243 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6850
Clone Number 4A7
Iso type IgM Kappa

Enviar uma mensagem


SYK monoclonal antibody (M01A), clone 4A7

SYK monoclonal antibody (M01A), clone 4A7