SYK purified MaxPab rabbit polyclonal antibody (D01P)
  • SYK purified MaxPab rabbit polyclonal antibody (D01P)

SYK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006850-D01P
SYK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SYK protein.
Información adicional
Size 100 ug
Gene Name SYK
Gene Alias DKFZp313N1010|FLJ25043|FLJ37489
Gene Description spleen tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SYK (NP_003168.2, 1 a.a. ~ 635 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6850

Enviar uma mensagem


SYK purified MaxPab rabbit polyclonal antibody (D01P)

SYK purified MaxPab rabbit polyclonal antibody (D01P)