SUPT5H monoclonal antibody (M04A), clone 1G3
  • SUPT5H monoclonal antibody (M04A), clone 1G3

SUPT5H monoclonal antibody (M04A), clone 1G3

Ref: AB-H00006829-M04A
SUPT5H monoclonal antibody (M04A), clone 1G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SUPT5H.
Información adicional
Size 200 uL
Gene Name SUPT5H
Gene Alias FLJ34157|SPT5|SPT5H
Gene Description suppressor of Ty 5 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUPT5H (AAH24203, 981 a.a. ~ 1087 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6829
Clone Number 1G3
Iso type IgG2b Kappa

Enviar uma mensagem


SUPT5H monoclonal antibody (M04A), clone 1G3

SUPT5H monoclonal antibody (M04A), clone 1G3