SUPT4H1 monoclonal antibody (M01), clone 3G4
  • SUPT4H1 monoclonal antibody (M01), clone 3G4

SUPT4H1 monoclonal antibody (M01), clone 3G4

Ref: AB-H00006827-M01
SUPT4H1 monoclonal antibody (M01), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SUPT4H1.
Información adicional
Size 100 ug
Gene Name SUPT4H1
Gene Alias SPT4|SPT4H|SUPT4H
Gene Description suppressor of Ty 4 homolog 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq LCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUPT4H1 (NP_003159, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6827
Clone Number 3G4
Iso type IgG2a Kappa

Enviar uma mensagem


SUPT4H1 monoclonal antibody (M01), clone 3G4

SUPT4H1 monoclonal antibody (M01), clone 3G4