SUOX polyclonal antibody (A01)
  • SUOX polyclonal antibody (A01)

SUOX polyclonal antibody (A01)

Ref: AB-H00006821-A01
SUOX polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SUOX.
Información adicional
Size 50 uL
Gene Name SUOX
Gene Alias -
Gene Description sulfite oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUOX (NP_000447, 391 a.a. ~ 486 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6821

Enviar uma mensagem


SUOX polyclonal antibody (A01)

SUOX polyclonal antibody (A01)