STXBP3 purified MaxPab mouse polyclonal antibody (B01P)
  • STXBP3 purified MaxPab mouse polyclonal antibody (B01P)

STXBP3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006814-B01P
STXBP3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STXBP3 protein.
Información adicional
Size 50 ug
Gene Name STXBP3
Gene Alias MUNC18-3|MUNC18C|PSP|UNC-18C
Gene Description syntaxin binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYRAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISFIPHESQVYTRDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHSQLLIIDRGFDPVSTVLHELTFQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STXBP3 (AAH38099.1, 1 a.a. ~ 592 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6814

Enviar uma mensagem


STXBP3 purified MaxPab mouse polyclonal antibody (B01P)

STXBP3 purified MaxPab mouse polyclonal antibody (B01P)