STX5A monoclonal antibody (M01), clone 5A6
  • STX5A monoclonal antibody (M01), clone 5A6

STX5A monoclonal antibody (M01), clone 5A6

Ref: AB-H00006811-M01
STX5A monoclonal antibody (M01), clone 5A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STX5A.
Información adicional
Size 100 ug
Gene Name STX5
Gene Alias SED5|STX5A
Gene Description syntaxin 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STX5A (NP_003155.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6811
Clone Number 5A6
Iso type IgG1 Kappa

Enviar uma mensagem


STX5A monoclonal antibody (M01), clone 5A6

STX5A monoclonal antibody (M01), clone 5A6