STX4A monoclonal antibody (M02), clone 6A1
  • STX4A monoclonal antibody (M02), clone 6A1

STX4A monoclonal antibody (M02), clone 6A1

Ref: AB-H00006810-M02
STX4A monoclonal antibody (M02), clone 6A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STX4A.
Información adicional
Size 100 ug
Gene Name STX4
Gene Alias STX4A|p35-2
Gene Description syntaxin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STX4A (NP_004595, 19 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6810
Clone Number 6A1
Iso type IgG1 Kappa

Enviar uma mensagem


STX4A monoclonal antibody (M02), clone 6A1

STX4A monoclonal antibody (M02), clone 6A1