STX1A MaxPab rabbit polyclonal antibody (D01)
  • STX1A MaxPab rabbit polyclonal antibody (D01)

STX1A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00006804-D01
STX1A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STX1A protein.
Información adicional
Size 100 uL
Gene Name STX1A
Gene Alias HPC-1|STX1|p35-1
Gene Description syntaxin 1A (brain)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STX1A (AAH03011.1, 1 a.a. ~ 251 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6804

Enviar uma mensagem


STX1A MaxPab rabbit polyclonal antibody (D01)

STX1A MaxPab rabbit polyclonal antibody (D01)