CDKL5 monoclonal antibody (M01), clone 1D9
  • CDKL5 monoclonal antibody (M01), clone 1D9

CDKL5 monoclonal antibody (M01), clone 1D9

Ref: AB-H00006792-M01
CDKL5 monoclonal antibody (M01), clone 1D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDKL5.
Información adicional
Size 100 ug
Gene Name CDKL5
Gene Alias ISSX|STK9
Gene Description cyclin-dependent kinase-like 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKL5 (AAH36091, 722 a.a. ~ 831 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6792
Clone Number 1D9
Iso type IgG1 kappa

Enviar uma mensagem


CDKL5 monoclonal antibody (M01), clone 1D9

CDKL5 monoclonal antibody (M01), clone 1D9