STK4 monoclonal antibody (M01), clone 1D7-8A10
  • STK4 monoclonal antibody (M01), clone 1D7-8A10

STK4 monoclonal antibody (M01), clone 1D7-8A10

Ref: AB-H00006789-M01
STK4 monoclonal antibody (M01), clone 1D7-8A10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant STK4.
Información adicional
Size 100 ug
Gene Name STK4
Gene Alias DKFZp686A2068|KRS2|MST1|YSK3
Gene Description serine/threonine kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STK4 (AAH05231, 1 a.a. ~ 39 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6789
Clone Number 1D7-8A10
Iso type IgG1 kappa

Enviar uma mensagem


STK4 monoclonal antibody (M01), clone 1D7-8A10

STK4 monoclonal antibody (M01), clone 1D7-8A10