STK4 polyclonal antibody (A01)
  • STK4 polyclonal antibody (A01)

STK4 polyclonal antibody (A01)

Ref: AB-H00006789-A01
STK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STK4.
Información adicional
Size 50 uL
Gene Name STK4
Gene Alias DKFZp686A2068|KRS2|MST1|YSK3
Gene Description serine/threonine kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STK4 (NP_006273, 391 a.a. ~ 485 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6789

Enviar uma mensagem


STK4 polyclonal antibody (A01)

STK4 polyclonal antibody (A01)