STK3 purified MaxPab rabbit polyclonal antibody (D01P)
  • STK3 purified MaxPab rabbit polyclonal antibody (D01P)

STK3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006788-D01P
STK3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STK3 protein.
Información adicional
Size 100 ug
Gene Name STK3
Gene Alias FLJ90748|KRS1|MST2
Gene Description serine/threonine kinase 3 (STE20 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,PLA-Ce,IF
Immunogen Prot. Seq MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STK3 (NP_006272.2, 1 a.a. ~ 491 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6788

Enviar uma mensagem


STK3 purified MaxPab rabbit polyclonal antibody (D01P)

STK3 purified MaxPab rabbit polyclonal antibody (D01P)