NEK4 monoclonal antibody (M01), clone 1B8
  • NEK4 monoclonal antibody (M01), clone 1B8

NEK4 monoclonal antibody (M01), clone 1B8

Ref: AB-H00006787-M01
NEK4 monoclonal antibody (M01), clone 1B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEK4.
Información adicional
Size 100 ug
Gene Name NEK4
Gene Alias MGC33171|NRK2|STK2|pp12301
Gene Description NIMA (never in mitosis gene a)-related kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEK4 (AAH63044, 680 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6787
Clone Number 1B8
Iso type IgG2a Kappa

Enviar uma mensagem


NEK4 monoclonal antibody (M01), clone 1B8

NEK4 monoclonal antibody (M01), clone 1B8