STCH purified MaxPab rabbit polyclonal antibody (D01P)
  • STCH purified MaxPab rabbit polyclonal antibody (D01P)

STCH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006782-D01P
STCH purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STCH protein.
Información adicional
Size 100 ug
Gene Name HSPA13
Gene Alias STCH
Gene Description heat shock protein 70kDa family, member 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAREMTILGSAVLTLLLAGYLAQQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STCH (NP_008879.3, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6782

Enviar uma mensagem


STCH purified MaxPab rabbit polyclonal antibody (D01P)

STCH purified MaxPab rabbit polyclonal antibody (D01P)