STAU1 monoclonal antibody (M02), clone 1E7
  • STAU1 monoclonal antibody (M02), clone 1E7

STAU1 monoclonal antibody (M02), clone 1E7

Ref: AB-H00006780-M02
STAU1 monoclonal antibody (M02), clone 1E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAU1.
Información adicional
Size 100 ug
Gene Name STAU1
Gene Alias FLJ25010|STAU
Gene Description staufen, RNA binding protein, homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAU1 (NP_004593, 401 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6780
Clone Number 1E7
Iso type IgG2b Kappa

Enviar uma mensagem


STAU1 monoclonal antibody (M02), clone 1E7

STAU1 monoclonal antibody (M02), clone 1E7