STAT6 monoclonal antibody (M01), clone 6C10
  • STAT6 monoclonal antibody (M01), clone 6C10

STAT6 monoclonal antibody (M01), clone 6C10

Ref: AB-H00006778-M01
STAT6 monoclonal antibody (M01), clone 6C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAT6.
Información adicional
Size 100 ug
Gene Name STAT6
Gene Alias D12S1644|IL-4-STAT|STAT6B|STAT6C
Gene Description signal transducer and activator of transcription 6, interleukin-4 induced
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAT6 (NP_003144, 694 a.a. ~ 801 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6778
Clone Number 6C10
Iso type IgG2b Kappa

Enviar uma mensagem


STAT6 monoclonal antibody (M01), clone 6C10

STAT6 monoclonal antibody (M01), clone 6C10