STAT5B monoclonal antibody (M03), clone 2D1
  • STAT5B monoclonal antibody (M03), clone 2D1

STAT5B monoclonal antibody (M03), clone 2D1

Ref: AB-H00006777-M03
STAT5B monoclonal antibody (M03), clone 2D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAT5B.
Información adicional
Size 100 ug
Gene Name STAT5B
Gene Alias STAT5
Gene Description signal transducer and activator of transcription 5B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq VYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAT5B (NP_036580, 678 a.a. ~ 787 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6777
Clone Number 2D1
Iso type IgG1 Kappa

Enviar uma mensagem


STAT5B monoclonal antibody (M03), clone 2D1

STAT5B monoclonal antibody (M03), clone 2D1