STAT4 purified MaxPab rabbit polyclonal antibody (D01P)
  • STAT4 purified MaxPab rabbit polyclonal antibody (D01P)

STAT4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006775-D01P
STAT4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STAT4 protein.
Información adicional
Size 100 ug
Gene Name STAT4
Gene Alias SLEB11
Gene Description signal transducer and activator of transcription 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGPLHNGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STAT4 (AAH31212.1, 1 a.a. ~ 748 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6775

Enviar uma mensagem


STAT4 purified MaxPab rabbit polyclonal antibody (D01P)

STAT4 purified MaxPab rabbit polyclonal antibody (D01P)