STAT3 monoclonal antibody (M02), clone 4D6
  • STAT3 monoclonal antibody (M02), clone 4D6

STAT3 monoclonal antibody (M02), clone 4D6

Ref: AB-H00006774-M02
STAT3 monoclonal antibody (M02), clone 4D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAT3.
Información adicional
Size 100 ug
Gene Name STAT3
Gene Alias APRF|FLJ20882|HIES|MGC16063
Gene Description signal transducer and activator of transcription 3 (acute-phase response factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAT3 (NP_003141, 670 a.a. ~ 769 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6774
Clone Number 4D6
Iso type IgG1 Kappa

Enviar uma mensagem


STAT3 monoclonal antibody (M02), clone 4D6

STAT3 monoclonal antibody (M02), clone 4D6