STAT3 purified MaxPab mouse polyclonal antibody (B01P)
  • STAT3 purified MaxPab mouse polyclonal antibody (B01P)

STAT3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006774-B01P
STAT3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STAT3 protein.
Información adicional
Size 50 ug
Gene Name STAT3
Gene Alias APRF|FLJ20882|HIES|MGC16063
Gene Description signal transducer and activator of transcription 3 (acute-phase response factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STAT3 (AAH14482.1, 1 a.a. ~ 770 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6774

Enviar uma mensagem


STAT3 purified MaxPab mouse polyclonal antibody (B01P)

STAT3 purified MaxPab mouse polyclonal antibody (B01P)