STAT2 monoclonal antibody (M02), clone 2E9
  • STAT2 monoclonal antibody (M02), clone 2E9

STAT2 monoclonal antibody (M02), clone 2E9

Ref: AB-H00006773-M02
STAT2 monoclonal antibody (M02), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAT2.
Información adicional
Size 100 ug
Gene Name STAT2
Gene Alias ISGF-3|MGC59816|P113|STAT113
Gene Description signal transducer and activator of transcription 2, 113kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAT2 (AAH51284, 742 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6773
Clone Number 2E9
Iso type IgG1 Kappa

Enviar uma mensagem


STAT2 monoclonal antibody (M02), clone 2E9

STAT2 monoclonal antibody (M02), clone 2E9