STAC monoclonal antibody (M01), clone 2C5
  • STAC monoclonal antibody (M01), clone 2C5

STAC monoclonal antibody (M01), clone 2C5

Ref: AB-H00006769-M01
STAC monoclonal antibody (M01), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAC.
Información adicional
Size 100 ug
Gene Name STAC
Gene Alias FLJ32331|STAC1
Gene Description SH3 and cysteine rich domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTYVALYKFVPQENEDLEMRPGDIITLLEDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAC (AAH20221, 209 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6769
Clone Number 2C5
Iso type IgG1 Kappa

Enviar uma mensagem


STAC monoclonal antibody (M01), clone 2C5

STAC monoclonal antibody (M01), clone 2C5