SRY purified MaxPab mouse polyclonal antibody (B01P)
  • SRY purified MaxPab mouse polyclonal antibody (B01P)

SRY purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006736-B01P
SRY purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SRY protein.
Información adicional
Size 50 ug
Gene Name SRY
Gene Alias TDF|TDY
Gene Description sex determining region Y
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SRY (NP_003131.1, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6736

Enviar uma mensagem


SRY purified MaxPab mouse polyclonal antibody (B01P)

SRY purified MaxPab mouse polyclonal antibody (B01P)