SRP68 monoclonal antibody (M03), clone 3A3
  • SRP68 monoclonal antibody (M03), clone 3A3

SRP68 monoclonal antibody (M03), clone 3A3

Ref: AB-H00006730-M03
SRP68 monoclonal antibody (M03), clone 3A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SRP68.
Información adicional
Size 100 ug
Gene Name SRP68
Gene Alias -
Gene Description signal recognition particle 68kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SRP68 (NP_055045.2, 531 a.a. ~ 627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6730
Clone Number 3A3
Iso type IgG2a Kappa

Enviar uma mensagem


SRP68 monoclonal antibody (M03), clone 3A3

SRP68 monoclonal antibody (M03), clone 3A3