SRP54 monoclonal antibody (M01), clone 2G7
  • SRP54 monoclonal antibody (M01), clone 2G7

SRP54 monoclonal antibody (M01), clone 2G7

Ref: AB-H00006729-M01
SRP54 monoclonal antibody (M01), clone 2G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SRP54.
Información adicional
Size 100 ug
Gene Name SRP54
Gene Alias -
Gene Description signal recognition particle 54kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SRP54 (NP_003127.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6729
Clone Number 2G7
Iso type IgG2a Kappa

Enviar uma mensagem


SRP54 monoclonal antibody (M01), clone 2G7

SRP54 monoclonal antibody (M01), clone 2G7