SREBF1 monoclonal antibody (M03), clone 4G4
  • SREBF1 monoclonal antibody (M03), clone 4G4

SREBF1 monoclonal antibody (M03), clone 4G4

Ref: AB-H00006720-M03
SREBF1 monoclonal antibody (M03), clone 4G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SREBF1.
Información adicional
Size 100 ug
Gene Name SREBF1
Gene Alias SREBP-1c|SREBP1|bHLHd1
Gene Description sterol regulatory element binding transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6720
Clone Number 4G4
Iso type IgG2a Kappa

Enviar uma mensagem


SREBF1 monoclonal antibody (M03), clone 4G4

SREBF1 monoclonal antibody (M03), clone 4G4