AKR1D1 monoclonal antibody (M01), clone 1A6
  • AKR1D1 monoclonal antibody (M01), clone 1A6

AKR1D1 monoclonal antibody (M01), clone 1A6

Ref: AB-H00006718-M01
AKR1D1 monoclonal antibody (M01), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AKR1D1.
Información adicional
Size 100 ug
Gene Name AKR1D1
Gene Alias 3o5bred|SRD5B1
Gene Description aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,ELISA
Immunogen Prot. Seq NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKR1D1 (NP_005980, 227 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6718
Clone Number 1A6
Iso type IgG2b Kappa

Enviar uma mensagem


AKR1D1 monoclonal antibody (M01), clone 1A6

AKR1D1 monoclonal antibody (M01), clone 1A6