SQLE purified MaxPab rabbit polyclonal antibody (D01P)
  • SQLE purified MaxPab rabbit polyclonal antibody (D01P)

SQLE purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006713-D01P
SQLE purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SQLE protein.
Información adicional
Size 100 ug
Gene Name SQLE
Gene Alias FLJ30795
Gene Description squalene epoxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWTFLGIATFTYFYKKFGDFITLANREVLLCVLVFLSLGLVLSYRCRHRNGGLLGRQQSGSQFALFSDILSGLPFIGFFWAKSPPESENKEQLEARRRRKGTNISETSLIGTAACTSTSSQNDPEVIIVGAGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLGDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAEPNAKFIEGVVLQLLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SQLE (NP_003120.2, 1 a.a. ~ 574 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6713

Enviar uma mensagem


SQLE purified MaxPab rabbit polyclonal antibody (D01P)

SQLE purified MaxPab rabbit polyclonal antibody (D01P)