SPTBN2 polyclonal antibody (A01)
  • SPTBN2 polyclonal antibody (A01)

SPTBN2 polyclonal antibody (A01)

Ref: AB-H00006712-A01
SPTBN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPTBN2.
Información adicional
Size 50 uL
Gene Name SPTBN2
Gene Alias GTRAP41|SCA5
Gene Description spectrin, beta, non-erythrocytic 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPTBN2 (NP_008877, 643 a.a. ~ 720 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6712

Enviar uma mensagem


SPTBN2 polyclonal antibody (A01)

SPTBN2 polyclonal antibody (A01)