SPRR3 monoclonal antibody (M01), clone 4A12
  • SPRR3 monoclonal antibody (M01), clone 4A12

SPRR3 monoclonal antibody (M01), clone 4A12

Ref: AB-H00006707-M01
SPRR3 monoclonal antibody (M01), clone 4A12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SPRR3.
Información adicional
Size 100 ug
Gene Name SPRR3
Gene Alias -
Gene Description small proline-rich protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPRR3 (AAH17802, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6707
Clone Number 4A12
Iso type IgG3 Kappa

Enviar uma mensagem


SPRR3 monoclonal antibody (M01), clone 4A12

SPRR3 monoclonal antibody (M01), clone 4A12